LL - 37,Cathelicidin, Antimicrobial Peptide, human

Product Name
LL37, Cathelicidin, Antimicrobial Peptide, human
Product Quantity
1 mg, 5 mg
Purity
>95%
Catalog Number
LT12016
Molecular Weight
4493.37
Formula
C205H340N60O53
Sequence (One-Letter Code)
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence (Three-Letter Code)
H - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH
Description
Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). LL-37 is used to study host defense mechanisms. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. LL-37 is a multifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.
  • 5 Units in Stock

Ask a Question

Starting at: $175.00

Please Choose:

Starting at: $175.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein