|
| ADAM9 Rabbit mAb |
|
| LTA24714 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Several alternatively spliced transcript variants have been identified for this gene. |
|
| MCMP; MDC9; CORD9; Mltng |
|
| 8754,sc-23290,sc-50332,ADAM9,CORD9,MCMP,MDC9,Mltng,ADAM metallopeptidase domain 9,disintegrin and metalloproteinase domain-containing protein 9,ADAM metallopeptidase domain 9 (meltrin gamma),cellular disintegrin-related protein,cone rod dystrophy 9,metalloprotease/disintegrin/cysteine-rich protein 9,myeloma cell metalloproteinase,Q13443,ADAM Metallopeptidase Domain 9,Metalloprotease/Disintegrin/Cysteine-Rich Protein 9,Cellular Disintegrin-Related Protein,Myeloma Cell Metalloproteinase,Cone Rod Dystrophy 9,Disintegrin And Metalloproteinase Domain-Containing Protein 9,A Disintegrin And Metalloproteinase Domain 9 (Meltrin Gamma),ADAM Metallopeptidase Domain 9 (Meltrin Gamma),Meltrin-Gamma,Meltrin Gamma,EC 3.4.24.-,KIAA0021,ADAM 9,MLTNG |
|
| Human |
|
| 8754 |
|
| Q13443 |
|
| AARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 29-210 of human ADAM9 (NP_003807.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 91kDa |
|
| WB,1:6500 - 1:13000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using ADAM9 Rabbit mAb (LTA24714) at 1:13000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Enhanced Kit (LT00021).|Exposure time: 30s. |
