|
| ADRP/Perilipin 2 Rabbit mAb |
|
| LTA24756 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene belongs to the perilipin family, members of which coat intracellular lipid storage droplets. This protein is associated with the lipid globule surface membrane material, and maybe involved in development and maintenance of adipose tissue. However, it is not restricted to adipocytes as previously thought, but is found in a wide range of cultured cell lines, including fibroblasts, endothelial and epithelial cells, and tissues, such as lactating mammary gland, adrenal cortex, Sertoli and Leydig cells, and hepatocytes in alcoholic liver cirrhosis, suggesting that it may serve as a marker of lipid accumulation in diverse cell types and diseases. Alternatively spliced transcript variants have been found for this gene. |
|
| ADFP; ADRP |
|
| 123,sc-32448,sc-32450,sc-32888,ADFP,Adipophilin,ADRP,Perilipin 2,PLIN2,perilipin 2,perilipin-2,adipophilin,adipose differentiation-related protein,Q99541,Adipose Differentiation-Related Protein,Perilipin-2 |
|
| Human |
|
| 123 |
|
| Q99541 |
|
| NIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQ |
|
| A synthetic peptide corresponding to a sequence within amino acids 331-430 of human ADRP/Perilipin 2 (NP_001113.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 48kDa |
|
| IF/ICC,1:100 - 1:400|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunofluorescence analysis of Hep G2 cells using ADRP/Perilipin 2 Rabbit mAb (LTA24756) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(LT007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
