Product Name:Allograft Inflammatory Factor 1 Human Recombinant
Catalog Number: LTP2290
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: P55008Cytokines
Subcategory:Allograft Inflammatory Factor
Amino acid sequence: MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP.
The AIF1 Human Recombinant contains a total of 155 amino acids having a molecular Mass of 17.7kDa. The Human AIF1 is fused to a 9 amino acid long N-terminal His tag.
Formulation:Filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5.
Physical Appearance:Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 90% as determined by SDS PAGE.
Source:E. Coli.
Stability:For long term, store lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.The lyophilized protein remains stable for 24 months when stored at -20°C.
Synonyms: AIF-1, Allograft inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.