|
| _-Synuclein Rabbit mAb |
|
| LTA24791 |
|
| 100ul |
|
|
$750
In stock
|
|
| Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. |
|
| PD1; NACP; PARK1; PARK4 |
|
| 6622,Alpha synuclein,a-Synuclein,NACP,PARK1,PARK4,PD1,SNCA,synuclein alpha,alpha-synuclein,non A-beta component of AD amyloid,synuclein alpha-140,synuclein,alpha (non A4 component of amyloid precursor),P37840,Synuclein Alpha,Synuclein,Alpha (Non A4 Component Of Amyloid Precursor),Alpha-Synuclein,Parkinson Disease (Autosomal Dominant,Lewy Body) 4,Non-A4 Component Of Amyloid Precursor,Non A4 Component Of Amyloid Precursor,Non A-Beta Component Of AD Amyloid,Non-A Beta Component Of AD Amyloid,Synuclein Alpha-140,I+/--Synuclein,Î,±,-Synuclein |
|
| Human |
|
| 6622 |
|
| P37840 |
|
| MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human _-Synuclein (NP_000336.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human, Mouse, Rat |
|
| 14kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of paraffin-embedded Human brain tissue using _-Synuclein Rabbit mAb (LTA24791, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
