Amylin, rat

Product Name
Amylin, rat
Product Quantity
1mg

Product Description

Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP). Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach. amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments. amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion. Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers. CAS registry number: 124447-81-0

Catalog Number
LT0944
Molecular Weight
3920.6
Formula
C167H272N52O53S2
Sequence
H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: 2-7); KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
  • 4 Units in Stock

Ask a Question

$350.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Logo 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein