|
| C3AR1 Rabbit mAb |
|
| LTA24815 |
|
| 100ul |
|
|
$750
In stock
|
|
| C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide anion production, and bacterial opsonization. |
|
| AZ3B; C3AR; HNFAG09 |
|
| 719,sc-14621,sc-20138,C3AR1,AZ3B,C3AR,HNFAG09,complement C3a receptor 1,C3a anaphylatoxin chemotactic receptor,complement component 3 receptor 1,complement component 3a receptor 1,Q16581,Complement C3a Receptor 1,Complement Component 3a Receptor 1,C3a Anaphylatoxin Chemotactic Receptor,Complement Component 3 Receptor 1,C3a-R,C3R1 |
|
| Human |
|
| 719 |
|
| Q16581 |
|
| MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPS |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human C3AR1 (NP_004045.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Mouse |
|
| 54kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of paraffin-embedded Mouse heart tissue using C3AR1 Rabbit mAb (LTA24815, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
