|
| CD62E/E-Selectin Rabbit mAb |
|
| LTA24766 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. |
|
| ELAM; ESEL; CD62E; ELAM1; LECAM2; selectin-e |
|
| 6401,sc-6937,sc-14011,SELE,CD62E,ELAM,ELAM1,ESEL,LECAM2,selectin E,E-selectin,CD62 antigen-like family member E,ELAM-1,endothelial adhesion molecule 1,endothelial leukocyte adhesion molecule 1,leukocyte endothelial cell adhesion molecule 2,P16581,Selectin E,Endothelial Leukocyte Adhesion Molecule 1,CD62 Antigen-Like Family Member E,Endothelial Adhesion Molecule 1,Leukocyte Endothelial Cell Adhesion Molecule 2,Leukocyte-Endothelial Cell Adhesion Molecule 2,CD62E Antigen,E-Selectin |
|
| Human |
|
| 6401 |
|
| P16581 |
|
| WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEW |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 22-230 of human CD62E/E-Selectin (NP_000441.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 67kDa |
|
| WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Recombinant Human E-Selectin/CD62E Protein (RP00380) cells using CD62E/E-Selectin Rabbit mAb (LTA24766) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 5ng _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 1s. |
