|
| CPT1C Rabbit mAb |
|
| LTA24809 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein regulates the beta-oxidation and transport of long-chain fatty acids into mitochondria, and may play a role in the regulation of feeding behavior and whole-body energy homeostasis. Alternatively spliced transcript variants encoding multiple protein isoforms have been observed for this gene. |
|
| CATL1; CPT1P; CPTIC; SPG73; CPT1-B; CPTI-B |
|
| 126129,sc-139480,sc-139479,CATL1,CPT IC,CPT1 B,CPT1C,CPT1P,CPTI B,CPTIC,CPT1-B,CPTI-B,SPG73,carnitine palmitoyltransferase 1C,carnitine O-palmitoyltransferase 1,brain isoform,carnitine O-palmitoyltransferase I,carnitine palmitoyltransferase I related C,Q8TCG5,Cpt1c,Carnitine Palmitoyltransferase 1C,Carnitine O-Palmitoyltransferase I,Brain Isoform,Carnitine O-Palmitoyltransferase 1,Carnitine Palmitoyltransferase I Related C,EC 2.3.1.21 |
|
| Human |
|
| 126129 |
|
| Q8TCG5 |
|
| MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDF |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human CPT1C (NP_689572.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Mouse, Rat |
|
| 91kDa |
|
| IF/ICC,1:100 - 1:400|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of paraffin-embedded Rat brain tissue using CPT1C Rabbit mAb (LTA24809, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
