Curli production assembly transport protein CsgF

Product Name

Curli production assembly/transport protein CsgF [Escherichia coli]

TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO)

Product Quantity
4mg
Catalog Number
LT8216
Sequence

Curli production assembly/transport protein CsgF [Escherichia coli]

TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO)

Product Description


A key part of bacterial biofilms is the curli amyloid fibrils produced by the curli biogenesis system. Understanding how curli biogenesis works is crucial for developing treatments for biofilm-related infections. The curli biogenesis system was examined, focusing on the structure, chemistry, and function of the secretion channel complexes (CsgF-CsgG) with and without the curli substrate. A dual-pore design in the CsgF-CsgG complex was used to create a method for inhibiting curli secretion by physically reducing the size of the CsgF pore. It was discovered how CsgG recognizes the CsgA substrate. Nine crevices outside the CsgG channel serve as specific and highly conserved recognition sites for the CsgA N-terminus.

The curli production assembly/transport protein CsgF [Escherichia coli] can be conjugated with other compounds using click chemistry. TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO)

  • 10 Units in Stock

Ask a Question

$800.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Logo 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2025 LifeTein.com. Powered by LifeTein