A key part of bacterial biofilms is the curli amyloid fibrils produced by the curli biogenesis system. Understanding how curli biogenesis works is crucial for developing treatments for biofilm-related infections. The curli biogenesis system was examined, focusing on the structure, chemistry, and function of the secretion channel complexes (CsgF-CsgG) with and without the curli substrate. A dual-pore design in the CsgF-CsgG complex was used to create a method for inhibiting curli secretion by physically reducing the size of the CsgF pore. It was discovered how CsgG recognizes the CsgA substrate. Nine crevices outside the CsgG channel serve as specific and highly conserved recognition sites for the CsgA N-terminus.
The curli production assembly/transport protein CsgF [Escherichia coli] can be conjugated with other compounds using click chemistry. TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO)
|
