|
| CXCL9/MIG Rabbit mAb |
|
| LTA24789 |
|
| 100ul |
|
|
$750
In stock
|
|
| This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. |
|
| CMK; MIG; Humig; SCYB9; crg-10 |
|
| 4283,CXCL9,CMK,Humig,MIG,SCYB9,crg-10,C-X-C motif chemokine ligand 9,C-X-C motif chemokine 9,chemokine (C-X-C motif) ligand 9,gamma-interferon-induced monokine,monokine induced by gamma interferon,monokine induced by interferon-gamma,small-inducible cytokine B9,Q07325,C-X-C Motif Chemokine Ligand 9,Monokine Induced By Interferon-Gamma,Monokine Induced By Gamma Interferon,Gamma-Interferon-Induced Monokine,Chemokine (C-X-C Motif) Ligand 9,Small-Inducible Cytokine B9,C-X-C Motif Chemokine 9,Crg-10,HuMIG |
|
| Human |
|
| 4283 |
|
| Q07325 |
|
| TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of human CXCL9/MIG (NP_002407.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 14kDa |
|
| WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Recombinant Human CXCL9/MIG Protein (RP00352) using CXCL9/MIG Rabbit mAb (LTA24789) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 5ng,1ng per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 20s. |
