| Cys-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly, C-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on developing this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy. The cysteine can be used to conjugate with the nanoparticles or other compounds. The click chemistry can be used for the peptide oligo conjugation, peptide compound, or peptide protein conjugations. |
