Cysteine-GLP-1 (1-37) (human, bovine,guinea pig, mouse, rat)

Product Name
Cysteine-GLP-1 (1-37) (human, bovine,guinea pig, mouse, rat)
Product Quantity
5mg
Catalog Number
310999
Molecular Weight
4272.71
Formula
C189H280N52O60S1
Sequence
Cys-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly, C-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on developing this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy. The cysteine can be used to conjugate with the nanoparticles or other compounds. The click chemistry can be used for the peptide oligo conjugation, peptide compound, or peptide protein conjugations.
  • 1 Units in Stock

Ask a Question

$660.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Logo 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2025 LifeTein.com. Powered by LifeTein