|
| Dectin-1 Rabbit mAb |
|
| LTA24767 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. |
|
| BGR; CD369; CANDF4; SCARE2; DECTIN1; CLECSF12 |
|
| 64581,sc-26094,CLEC7A,BGR,CANDF4,CD369,CLECSF12,DECTIN1,SCARE2,C-type lectin domain containing 7A,C-type lectin domain family 7 member A,C-type (calcium dependent,carbohydrate-recognition domain) lectin,superfamily member 12,C-type lectin superfamily member 12,DC-associated C-type lectin 1,beta-glucan receptor,dectin-1,dendritic cell-associated C-type lectin-1,lectin-like receptor 1,Q9BXN2,Clec7a,C-Type Lectin Domain Containing 7A,C-Type (Calcium Dependent,Carbohydrate-Recognition Domain) Lectin,Superfamily Member 12,C-Type Lectin Domain Family 7 Member A,C-Type Lectin Superfamily Member 12,DC-Associated C-Type Lectin 1,Beta-Glucan Receptor,Dectin-1,Dendritic Cell-Associated C-Type Lectin-1,Dendritic Cell-Associated C-Type Lectin 1,C-Type Lectin Domain Family 7,Member A,Lectin-Like Receptor 1 |
|
| Human |
|
| 64581 |
|
| Q9BXN2 |
|
| TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 66-247 of human Dectin-1 (NP_922938.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Mouse, Rat |
|
| 28kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunofluorescence analysis of Mouse spleen tissue using Dectin-1 Rabbit mAb (LTA24767) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(LT007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. |
