|
| FXR/NR1H4 Rabbit mAb |
|
| LTA24775 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates the expression of genes involved in bile acid synthesis and transport. Alternatively spliced transcript variants encoding different isoforms have been described. |
|
| BAR; FXR; HRR1; HRR-1; PFIC5; RIP14 |
|
| 9971,sc-1205,sc-1204,sc-13063,NR1H4,BAR,FXR,HRR-1,HRR1,PFIC5,RIP14,nuclear receptor subfamily 1 group H member 4,bile acid receptor,RXR-interacting protein 14,farnesoid X nuclear receptor,farnesoid X-activated receptor,farnesol receptor HRR-1,retinoid X receptor-interacting protein 14,Q96RI1,Nuclear Receptor Subfamily 1 Group H Member 4,Retinoid X Receptor-Interacting Protein 14,Farnesoid X-Activated Receptor,RXR-Interacting Protein 14,Farnesol Receptor HRR-1,Bile Acid Receptor,Nuclear Receptor Subfamily 1,Group H,Member 4,Farnesoid X Nuclear Receptor,Farnesoid X Receptor |
|
| Human |
|
| 9971 |
|
| Q96RI1 |
|
| MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHA |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human FXR/NR1H4 (NP_001193922.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 56kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Hep G2 cells using FXR/NR1H4 Rabbit mAb (LTA24775) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 90s. |
