Product Name:Interleukin-37 Human Recombinant
Catalog Number: LTP2467
Product Size: 25µg
Transportation method:Shipped at Room temp
Uniprot ACC#: Q9NZH6Cytokines
Subcategory:Interleukin
Amino acid sequence: MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD.
Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa.The IL37 is purified by proprietary chromatographic techniques.
Formulation:IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source:Escherichia Coli.
Stability:Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Synonyms: Interleukin-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, IL-1F7, Interleukin-1 homolog 4, IL-1H, IL-1H4, Interleukin-1 zeta, IL-1 zeta, Interleukin-1-related protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1, FIL1, FIL1(ZETA).
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.