|
| IRP2 Rabbit mAb |
|
| LTA24724 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene is an RNA-binding protein that acts to regulate iron levels in the cells by regulating the translation and stability of mRNAs that affect iron homeostasis under conditions when iron is depleted. When iron levels are low, this protein binds to iron-responsive elements (IRES), stem-loop structures located either in the 5' or 3' UTRs. Binding to the 5' UTR represses translation, while binding to the 3' UTR inhibits mRNA degradation. When iron is found in the cell, this protein is degraded in a F-box and leucine rich repeat protein 5-dependent manner. Variants in this gene have been associated with lung cancer and chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants encoding different isoforms. |
|
| ACO3; IRP2; IRP2AD; NDCAMA; IRE-BP2; IRE-BP 2 |
|
| 3658,IREB2,ACO3,IRP2,IRP2AD,iron responsive element binding protein 2,iron-responsive element-binding protein 2,IRE-BP 2,iron regulatory protein 2,P48200,Iron Responsive Element Binding Protein 2,Iron Regulatory Protein 2,Iron-Responsive Element-Binding Protein 2,IRE-BP2 |
|
| Human |
|
| 3658 |
|
| P48200 |
|
| SLEAPDSVLFPWDLKSTYIRCPSFFDKLTKEPIALQAIENAHVLLYLGDSVTTDHISPAGSIARNSAAAKYLTNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIPLIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENADSLGLSGRETFSLTFPEELSPGITLNIQTSTGKVFSVIASFEDDVEITLYKHGGLLNFVARKFS |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 700-963 of human IRP2 (NP_004127.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 105kDa |
|
| WB,1:2500 - 1:10000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using IRP2 Rabbit mAb (LTA24724) at 1:2500 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 30s. |
