| [KD Validated] PSAP Rabbit mAb |
| LTA24738 |
| 100ul |
|
$750
In stock
|
| This gene encodes a highly conserved preproprotein that is proteolytically processed to generate four main cleavage products including saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. |
| GLBA; SAP1; SAP2; PSAPD; PARK24 |
| 5660,sc-27014,sc-27018,sc-27012,sc-32875,A1 activator,Cerebroside sulfate activator,Co beta glucosidase,Component C,CSAct,Dispersin,GLBA,Glucosylceramidase activator,Proactivator polypeptide,prosaposin,Protein C,PSAP,SAP 1,SAP 2 Saposin D,SAP1,proactivator polypeptide,sphingolipid activator protein-1,P07602,Prosaposin,Sphingolipid Activator Protein-1,Proactivator Polypeptide,Variant Gaucher Disease And Variant Metachromatic Leukodystrophy |
| Human |
| 5660 |
| P07602 |
| KEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN |
| Recombinant fusion protein containing a sequence corresponding to amino acids 275-524 of human PSAP (NP_002769.1). |
| Rabbit |
| Affinity Purified Monoclonal IgG |
| WB, ELISA |
| Human |
| 58kDa |
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
Shipped at ambient temperature.
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
Western blot analysis of lysates from wild type (WT) and PSAP knockdown (KD) 293T cells using [KD Validated] PSAP Rabbit mAb (LTA24738) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 90s. |