| LL37, Cathelicidin, Antimicrobial Peptide, human |
| 1 mg, 5 mg |
| >95% |
| LT12016 |
| 4493.37 |
| C205H340N60O53 |
Sequence (One-Letter Code) | [LL-37, 37 aa] |
Sequence (Three-Letter Code) | H - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH |
| Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). LL-37 is used to study host defense mechanisms. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. LL-37 is a multifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution. |
