LL-37 (All D amino acid), Antimicrobial Peptide, human

Catalog #: LT12017
Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, All D amino acids
MW: 4493.37
Quantity: 1 mg
Purity: >90% by HPLC
Appearance: Freeze dried solid
Formula: C205H341N61O52
CAS: 143108-26-3
Solubility Soluble in dilute acid
Long Term Storage: Store dry, dark and frozen
Miscellaneous/General:

Antimicrobial peptides (AMPs) are peptides that form part of the host's important innate immunity mechanism against pathogenic microorganisms such as Gram-positive and negative bacteria, fungi, and viruses. AMPs are short peptides, exhibit a broad-spectrum antimicrobial activity at physiological conditions, and are predominantly cationic.

LL-37 is a 37 amino acid host defense peptide derived from the C-terminus of the only human calethicidin, hCAP18. This peptide has been found in many different cell types and body fluids and is linked with antimicrobial, antitumor, antiviral and immunomodulatory properties.

Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution. In addition, LL-37 has been shown to play a role in chemoattraction, dendritic cell differentiation, mast cell degranulation, cytokine secretion, and angiogenesis stimulation. LL-37 has also been investigated as a wound-healing agent. In other species, the C-terminal antimicrobial region varies in sizes, sequences, and structures.

LifeTein's LL-37 is an all-D-amino acid peptide. Please read more details about the D amino acid peptides: https://www.lifetein.com/Peptide-Synthesis-D-Amino-Acid.html

Product Literature References

Turner et.al.  Antimicrob. Agents Chemother. (1998)  42(9) 2206-2214

Wu  et.al.  Int. J. Cancer (2010)  127(8) 1741 - 1747

Chow  et.al.  World J. Gastroenterol (2013)  19(18) 2731-2735

  • 5 Units in Stock

Ask a Question

$510.00

Add to Cart:

Max: 5
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Logo 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein