|
| Monkeypox virus (MPXV) A35R Rabbit mAb |
|
| LTA24781 |
|
| 100ul |
|
|
$750
In stock
|
|
| Luteinizing Hormone ( LH ) is a 42-kda heterodimer belonging to the glycoprotein hormone family. It is composed of non-covalently linked sugar chains and chains. The _ subunit ( CG_ ) is also a component of follicle stimulating hormone ( FSH ), thyroid stimulating hormone and chorionic gonadotropin. The unique _ subunit gives the protein a specific biological role and is responsible for its interaction with its receptors )Luteinizing hormone is secreted by the anterior pituitary. Its secretion is controlled by gonadotropin-releasing hormone secreted by the hypothalamus ; however, luteinizing hormone secretion can also be stimulated by estradiol. Luteinizing hormone and FSH synergistically regulate female reproduction ; follicle stimulating hormone stimulates follicular growth, and luteinizing hormone induces ovulation. Luteinizing hormone also promotes the formation of corpus luteum by promoting the production of progesterone. In addition, luteinizing hormone is also thought to stimulate the adrenal glands of postmenopausal women and induce the secretion of dehydroepiandrosterone sulfate ( DHEA ), a precursor of androgens. In the testis, luteinizing hormone induces Leydig cells to produce testosterone. Excessive luteinizing hormone secretion has been shown to occur in women with polycystic ovary syndrome and is associated with an increased risk of infertility and miscarriage. In addition, elevated serum LH levels are associated with decreased cognitive ability and are associated with the development and progression of Alzheimer 's disease. |
|
| A35R |
|
| A35R |
|
| Human |
|
| 928958 |
|
| Q8V4U4 |
|
| RQNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCT |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 58-181 of monkeypox virus (strain Zaire-96-I-16) Monkeypox virus (MPXV) A35R (NP_536572.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 20kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of 293T cells transfected with Monkeypox virus (MPXV) A35R using Monkeypox virus (MPXV) A35R Rabbit mAb (LTA24781, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x. |
