|
| Occludin Rabbit mAb |
|
| LTA24780 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5. |
|
| BLCPMG; PTORCH1; PPP1R115 |
|
| 100506658,sc-8145,sc-8144,sc-27151,sc-5562,OCLN,BLCPMG,PPP1R115,occludin,phosphatase 1,regulatory subunit 115,tight junction protein occludin,Q16625,Ocln,Occludin,Phosphatase 1,Regulatory Subunit 115,Tight Junction Protein Occludin TM4 Minus,Tight Junction Protein Occludin,PTORCH1 |
|
| Human |
|
| 100506658 |
|
| Q16625 |
|
| GGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 405-522 of human Occludin (NP_001192183.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Mouse, Rat |
|
| 59kDa |
|
| WB,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Mouse liver using Occludin Rabbit mAb (LTA24780) at 1:2000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 30s. |
