|
| PLPP3 Rabbit mAb |
|
| LTA24779 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. |
|
| LPP3; VCIP; Dri42; PAP2B; PPAP2B |
|
| 8613,PLPP3,Dri42,LPP3,PAP2B,PPAP2B,VCIP,phospholipid phosphatase 3,PAP2 beta,lipid phosphate phosphohydrolase 3,phosphatidate phosphohydrolase type 2b,phosphatidic acid phosphatase type 2B,type-2 phosphatidic acid phosphatase-beta,vascular endothelial growth factor and type I collagen inducible,O14495,Phospholipid Phosphatase 3,Phosphatidate Phosphohydrolase Type 2b,Phosphatidic Acid Phosphatase Type 2B,Lipid Phosphate Phosphohydrolase 3,Vascular Endothelial Growth Factor And Type I Collagen-Inducible Protein,Vascular Endothelial Growth Factor And Type I Collagen Inducible,Type-2 Phosphatidic Acid Phosphatase-Beta,Phosphatidic Acid Phosphatase 2b,EC 3.1.3.4,PAP2 Beta,PAP2-Beta,PAP-2b,PAP2b |
|
| Human |
|
| 8613 |
|
| O14495 |
|
| MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLPP3 (NP_003704.3). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 35kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using PLPP3 Rabbit mAb (LTA24779) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 60s. |
