|
| PSMC4 Rabbit mAb |
|
| LTA24740 |
|
| 100ul |
|
|
$750
In stock
|
|
| The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
|
| S6; RPT3; TBP7; TBP-7; MIP224 |
|
| 5704,sc-46465,sc-98797,MB67 interacting protein,MIP224,PSMC4,S6,Tat binding protein 7,TBP 7,TBP7,RPT3,TBP-7,proteasome 26S subunit,ATPase 4,26S protease regulatory subunit 6B,26S proteasome AAA-ATPase subunit RPT3,MB67-interacting protein,Tat-binding protein 7,protease 26S subunit 6,proteasome (prosome,macropain) 26S subunit,ATPase,4,P43686,Proteasome 26S Subunit,Tat-Binding Protein 7,Proteasome (Prosome,Macropain) 26S Subunit,26S Proteasome AAA-ATPase Subunit RPT3,MB67-Interacting Protein,Protease 26S Subunit 6,26S Proteasome Regulatory Subunit 6B,26S Protease Regulatory Subunit 6B,Proteasome 26S Subunit ATPase 4,MB67 Interacting Protein |
|
| Human |
|
| 5704 |
|
| P43686 |
|
| MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYA |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human PSMC4 (NP_006494.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IHC-P, ELISA |
|
| Human, Mouse, Rat |
|
| 47kDa |
|
| IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunohistochemistry analysis of paraffin-embedded Human testis tissue using PSMC4 Rabbit mAb (LTA24740) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
