|
| R9AP/RGS9BP Rabbit mAb |
|
| LTA24753 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene functions as a regulator of G protein-coupled receptor signaling in phototransduction. Studies in bovine and mouse show that this gene is expressed only in the retina, and is localized in the rod outer segment membranes. This protein is associated with a heterotetrameric complex, specifically interacting with the regulator of G-protein signaling 9, and appears to function as the membrane anchor for the other largely soluble interacting partners. Mutations in this gene are associated with prolonged electroretinal response suppression (PERRS), also known as bradyopsia. |
|
| R9AP; RGS9; PERRS |
|
| 388531,RGS9BP,PERRS,R9AP,RGS9,regulator of G-protein signaling 9 binding protein,regulator of G-protein signaling 9-binding protein,RGS9 anchor protein,RGS9-anchoring protein,Q6ZS82,Regulator Of G Protein Signaling 9 Binding Protein,RGS9-Anchoring Protein,Regulator Of G Protein Signalling 9 Binding Protein,Regulator Of G-Protein Signaling 9-Binding Protein,Regulator Of G-Protein Signaling 9 Binding Protein,RGS9 Anchor Protein |
|
| Human |
|
| 388531 |
|
| Q6ZS82 |
|
| MAREECKALLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEADMRRALELGAAFPLHA |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of human R9AP/RGS9BP (NP_997274.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 25kDa |
|
| IF/ICC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunofluorescence analysis of 293T cells transfected with R9AP/RGS9BP using R9AP/RGS9BP Rabbit mAb (LTA24753) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(LT007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
