|
| RNF8 Rabbit mAb |
|
| LTA24734 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene contains a RING finger motif and an FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. This protein is also known to play a role in the DNA damage response and depletion of this protein causes cell growth inhibition and cell cycle arrest. Alternative splicing results in multiple transcript variants. |
|
| hRNF8 |
|
| 9025,sc-49100,sc-49099,sc-133971,KIAA0646,ring finger protein 8,RNF8,hRNF8,E3 ubiquitin-protein ligase RNF8,C3HC4-type zinc finger protein,RING-type E3 ubiquitin transferase RNF8,UBC13/UEV-interacting ring finger protein,ring finger protein (C3HC4 type) 8,E3 ubiquitin protein ligase,O76064,Ring Finger Protein 8,RING-Type E3 Ubiquitin Transferase RNF8,HRNF8,E3 Ubiquitin Protein Ligase,UBC13/UEV-Interacting Ring Finger Protein,Ring Finger Protein (C3HC4 Type) 8,E3 Ubiquitin-Protein Ligase RNF8,C3HC4-Type Zinc Finger Protein,RING Finger Protein 8,EC 2.3.2.27 |
|
| Human |
|
| 9025 |
|
| O76064 |
|
| MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLK |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RNF8 (NP_003949.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 56kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using RNF8 Rabbit mAb (LTA24734) at 1:2000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 90s. |
