|
| RPGR Rabbit mAb |
|
| LTA24710 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a protein with a series of six RCC1-like domains (RLDs), characteristic of the highly conserved guanine nucleotide exchange factors. The encoded protein is found in the Golgi body and interacts with RPGRIP1. This protein localizes to the outer segment of rod photoreceptors and is essential for their viability. Mutations in this gene have been associated with X-linked retinitis pigmentosa (XLRP). Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length natures of only some have been determined. |
|
| CRD; RP3; COD1; PCDX; RP15; XLRP3; orf15; CORDX1 |
|
| 6103,sc-14672,COD1,CORDX1,CRD,orf15,PCDX,RP15,RP3,RPGR,XLRP3,retinitis pigmentosa GTPase regulator,X-linked retinitis pigmentosa GTPase regulator,retinitis pigmentosa 15,retinitis pigmentosa 3 GTPase regulator,Q92834,Retinitis Pigmentosa GTPase Regulator,Retinitis Pigmentosa 15,X-Linked Retinitis Pigmentosa GTPase Regulator,Retinitis Pigmentosa 3 GTPase Regulator,Cone Dystrophy 1 (X-Linked),Orf15 |
|
| Human |
|
| 6103 |
|
| Q92834-6 |
|
| MREPEELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTE |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RPGR (NP_001030025.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Mouse, Rat |
|
| 113kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using RPGR Rabbit mAb (LTA24710) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 90s. |
