Product Name:Secreted Phospholipase A2-IID Human Recombinant
Catalog Number: LTP3783
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: Q9UNK4Enzymes
Subcategory:Secreted Phospholipase A2
Amino acid sequence: MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.
Secreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues _ His-Tag (underlined).
Formulation:Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
Physical Appearance:Sterile Filtered lyophilized (freeze-dried) powder.
Purity:
Source:Escherichia Coli.
Stability:Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Synonyms: Group IID secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIID, GIID sPLA2, PLA2IID, sPLA(2)-IID, Secretory-type PLA, stroma-associated homolog, SPLASH, sPLA2S, PLA2G2D.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
