Product Name:Secreted Phospholipase A2-IIE Human Recombinant
Catalog Number: LTP3784
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: Q9NZK7Enzymes
Subcategory:Secreted Phospholipase A2
Amino acid sequence:
Secreted Phospholipase A2-IIE Human Recombinant manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues _ His-Tag (underlined).MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC.
Formulation:Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
Physical Appearance:Sterile Filtered lyophilized (freeze-dried) powder.
Purity:Greater than 95% as determined by SDS PAGE.
Source:Escherichia Coli.
Stability:Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Synonyms: Group IIE secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIIE, GIIE sPLA2, sPLA(2)-IIE, sPLA2-IIE, PLA2G2E.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
