Product Name:Secreted Phospholipase A2-X Human Recombinant
Catalog Number: LTP3786
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: O15496Enzymes
Subcategory:Secreted Phospholipase A2
Amino acid sequence:
Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Formulation:Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2.
Physical Appearance:Sterile Filtered lyophilized (freeze-dried) powder.
Purity:Greater than 95% as determined by SDS PAGE.
Source:Escherichia Coli.
Stability:Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Synonyms: Group 10 secretory phospholipase A2, EC 3.1.1.4, Group X secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase GX, GX sPLA2, sPLA2-X, SPLA2, GXPLA2, MGC119918, MGC119919, MGC133367, PLA2G10.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
