Product Name:Tumor Necrosis Factor Receptor Type Human Recombinant, His Tag
Catalog Number: LTP2754
Product Size: 20µg
Transportation method:Shipped with Ice Packs
Uniprot ACC#: P19438Cytokines
Subcategory:Tumor Necrosis Factor
Amino acid sequence: DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN.
TNFR Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques.
Formulation:TNFR His Tag protein is supplied in 1xPBS, 50% glycerol.
Physical Appearance:Sterile Filtered clear solution.
Purity:Greater than 95.0% as determined by SDS-PAGE.
Source:Escherichia Coli.
Stability:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Synonyms: Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.