|
| VIP Rabbit mAb |
|
| LTA24799 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
|
| PHM27 |
|
| 7432,sc-21041,sc-7841,sc-20727,VIP,PHM27,vasoactive intestinal peptide,VIP peptides,prepro-VIP,P01282,Vip,Vasoactive Intestinal Peptide,Prepro-VIP,VIP Peptides |
|
| Human |
|
| 7432 |
|
| P01282 |
|
| APSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human VIP (NP_003372.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 19kDa |
|
| IF/ICC,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of 293T cells transfected with VIP using VIP Rabbit mAb (LTA24799, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x. |
