Proteins

We provide MHC Complexes, Virus-Like Particles (VLPs) Antigens, Laminin 521, Cas9, Cas12a, cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies.


  Advanced Search

Featured Proteins

MHC (Major Histocompatibility Complex)

Peptide-ready Major Histocompatibility Complexes (MHCs) are a critical component of the adaptive immune system, responsible for presenting antigens to T-cells, which play a crucial role in immune responses. MHC molecules are highly polymorphic cell surface proteins found in vertebrates, including humans, and are encoded by a complex gene family. The related linear peptidic epitope sequences are: EVDPIGHLY, NTDNNLAVY, YTDNWLAVY, ALYVDSLFFL, CLGGLLTMV, ELAGIGILTV, FLLTRILTI, FMNKFIYEI, GLYDGMEHL, GVYDGREHTV, HMTEVVRHC, KLPQLCTEL, KLVVVGAGGV, KMVELVHFL, KVAELVHFL, KVLEHVVRV, LMLGEFLKL, NLVPMVATV, PLFQVPEPV, RMFPNAPYL, SLLMWITQC, SLLMWITQV, SLLQHLIGL, YLEPGPVTA, YMLDLQPET, FMNKFIYEI, VVGAVGVGK, SSCSSCPLTK, VVGADGVGK, VVVGAAGVGK, VVVGAVGVGK, AYACNTSTL, IMPKAGLLI, VYFFLPDHL, GADGVGKSAL, VMAPKTLVL, RIIPRHLQL, SIINFEKL, AMAPRTLLL, and NQKLIANQF.

LifeTein provides single-chain peptide-MHC monomers, biotinylated MHC monomers, tetramers, and biotinylated tetramers, MHC-I Virus-Like Particles, and multivalent fluorescent MHC-I Virus-Like Particles.Other catalog products include NY-ESO-1, KRAS, MAGE, GP100, AFP, LMP2, Survivin, HBV, HPV, WT-1, and P53. Our functional peptide-ready MHCs products are a ready-to-use loading system for loading neoantigen peptides to form a new complete MHC peptide complex.

Applications of peptide-ready MHCs:

  • Research: Peptide-MHC tetramers or multimers are widely used in immunological research to detect and characterize antigen-specific T-cells. These reagents enable the precise identification and quantification of T-cells recognizing specific peptide antigens.
  • Vaccine development: Understanding the peptide epitopes presented by MHC molecules is crucial for designing vaccines that can elicit effective T-cell responses against pathogens or cancer cells.
  • Immunotherapy: Peptide-based immunotherapies, such as peptide vaccines or adoptive T-cell therapy, utilize knowledge of peptide-MHC interactions to target specific antigens in cancer treatment and infectious disease control.

Virus-like particles (VLPs)-displayed antigens

LifeTein offers a series of Virus-like particles (VLPs)-displayed antigens. VLPs are nanoparticles derived from the capsid protein of a virus. Virus-like particles are used for antibody discovery for immunization and screening, affinity determination for ELISA, Surface Plasmon Resonance (SPR), in vivo pharmacokinetic analysis, CMC (Chemistry, Manufacturing, and Controls) method development, and CAR-T positive rate detection.

Search these featured VLPs from the search box above: Human GPRC5D Protein-VLP (LTP10647), Human CCR2b Protein-VLP (LTP10415), CD24 Protein-VLP (LTP10683), Human CD20 VLP, Human CD24 VLP, Human Claudin 18.2 VLP, Human Claudin 6 VLP, Biotinylated Human VLP Control, Mouse Claudin 6 VLP, Human SSTR2 VLP, Human Cannabinoid Receptor 2 Protein-VLP, Human A2AR VLP, Human TM4SF1 VLP, Human GPC3 (438-554) VLP, Mouse GPRC5D VLP, Cynomolgus GPRC5D VLP, Human GPC3 VLP, Human Adenosine receptor A2b Protein-VLP

CD3 proteins

LifeTein provides highly active CD3 proteins, including monomers, homodimers, heterodimers, and biotinylated proteins.

Here are the featured products: Biotinylated Cynomolgus CD3E&CD3D, hFc tag; Biotinylated Cynomolgus CD3E&CD3G, hFc tag; Cynomolgus CD3E, His tag; Human CD3E&CD3G, His tag; Mouse CD3E&CD3D, hFc tag; Human CD3E&CD3G, hFc tag; Biotinylated Human CD3E&CD3G, His tag; Biotinylated Human CD3E&CD3D, His Tag; Biotinylated Cynomolgus CD3E 1-27 peptide, hFc tag; Cynomolgus CD3E&CD3D, hFc tag; Human CD3E&CD3D, hFc tag; Biotinylated Human CD3E 1-27 peptide, hFc tag.

Immune Checkpoint Proteins

LifeTein produced a series of immune checkpoint proteins with multiple labels like biotin, FITC and PE. These products are available: Human EGFRVIII Protein, Human EGFR/HER1 Protein, Cynomolgus FAP Protein, Cynomolgus FOLR2 Protein, Human FOLR4/Juno Protein, Human GUCY2C, Human Her2/ErbB2 Protein and more. Please use the search box for more proteins.

Human leukocyte antigen-G (HLA-G) and receptors

We provide mammalian-derived HLA-G and their receptors, LILRB/LILRA, in various species and tags for first-in-class drug discovery. HLA-G mediates its function by binding to receptors on immune cells.

Featured Products include: Biotinylated Human APOE3; Human APOE4 hFc Tag; Human APOE4 His Tag; Biotinylated Human LILRB Domain 2; Biotinylated Human HLA-G; Human APOE3 His Tag; Biotinylated Human HLA-G Tetramer; Cynomolgus HLA-G; Human HLA-G Tetramer; Mouse APOE; Rhesus macaque HLA-G; Cynomolgus LILRA6.

Other Proteins

We have developed a high-quality Laminin 521 product and Human Wnt Surrogate-Fc Fusion Protein that can be applied to scientific research and preclinical development. Our active Cas9 protein carries a nuclear localization signal (NLS) design. The in-house active CRISPR-Cas12a enzyme can recognize and cut DNA at a specific site different from the prototypical Cas9. Order your Recombinant CRISPR Cas9 Protein and AsCas12a (CRISPR-associated nuclease Acidaminococcus sp. Cas12a) now.

                                                                                                                                                                               
LTP4418 Recombinant Mouse RANKL Protein $1000 $500
download pdf data sheet
LT13501 Macrophage Colony Stimulating Factor (M-CSF)$650 $300
download pdf data sheet
LTP10120$406
download pdf data sheet
LT13513$320
download pdf data sheet
LT12010  $230
download pdf data sheet

Displaying 5521 to 5530 (of 7269 Products)
Price Product Name-
$475.00... more info
Potassium Channel Tetramerisation Domain Containing 5 Human Reco
Product Name :Potassium Channel Tetramerisation Domain Containing 5 Human Recombinant Catalog Number : LTP6156 Product Size : 10µg Transportation method :Shipped with Ice Packs Uniprot ACC# : Q9NXV2Recombinant Proteins Subcategory :KCTD Amino...
$475.00... more info
POU class 2 associating factor 1 Human Recombinant
Product Name :POU class 2 associating factor 1 Human Recombinant Catalog Number : LTP7201 Product Size : 10µg Transportation method :Shipped with Ice Packs Uniprot ACC# : Q16633Recombinant Proteins Subcategory :POU Class Amino acid sequence :...
$475.00... more info
POU Class 5 Homeobox 1 Human Recombinant
Product Name :POU Class 5 Homeobox 1 Human Recombinant Catalog Number : LTP7198 Product Size : 20µg Transportation method :Shipped at Room temp Uniprot ACC# : Q01860Recombinant Proteins Subcategory :POU Class Amino acid sequence : MGSSHHHHHH...
$475.00... more info
POU Class 5 Homeobox 1 Human Recombinant, Polyarginine-Tag
Product Name :POU Class 5 Homeobox 1 Human Recombinant, Polyarginine-Tag Catalog Number : LTP7199 Product Size : 10µg Transportation method :Shipped with Ice Packs Uniprot ACC# : Q01860Recombinant Proteins Subcategory :POU Class Amino acid...
$475.00... more info
POU Class 6 Homeobox 1 Human Recombinant
Product Name :POU Class 6 Homeobox 1 Human Recombinant Catalog Number : LTP7200 Product Size : 20µg Transportation method :Shipped at Room temp Uniprot ACC# : Q14863Recombinant Proteins Subcategory :POU Class Amino acid sequence : MGSSHHHHHH...
$990.00... more info
Pramlintide
Product Name :Pramlintide Catalog Number : LTP4546 Product Size : 4mg Transportation method :Shipped at Room temp Uniprot ACC# : Hormones Subcategory :Peptide Hormones Amino acid sequence : KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2. Pramlintide...
$475.00... more info
Prealbumin Human Recombinant
Product Name :Prealbumin Human Recombinant Catalog Number : LTP5415 Product Size : 25µg Transportation method :Shipped with Ice Packs Uniprot ACC# : P02766Recombinant Proteins Subcategory :Albumin Amino acid sequence : MGPTGTGESK CPLMVKVLDA...
$475.00... more info
Precursor Brain-Derived Neurotrophic Factor Human Recombinant
Product Name :Precursor Brain-Derived Neurotrophic Factor Human Recombinant Catalog Number : LTP5317 Product Size : 10µg Transportation method :Shipped at Room temp Uniprot ACC# : P23560Neurotrophins Subcategory :Other Amino acid sequence :...
$475.00... more info
Prefoldin Subunit 1 Human Recombinant
Product Name :Prefoldin Subunit 1 Human Recombinant Catalog Number : LTP7206 Product Size : 5µg Transportation method :Shipped with Ice Packs Uniprot ACC# : O60925Recombinant Proteins Subcategory :Prefoldin Amino acid sequence : MGSSHHHHHH...
$475.00... more info
Prefoldin Subunit 2 Human Recombinant
Product Name :Prefoldin Subunit 2 Human Recombinant Catalog Number : LTP7202 Product Size : 10µg Transportation method :Shipped with Ice Packs Uniprot ACC# : Q9UHV9Recombinant Proteins Subcategory :Prefoldin Amino acid sequence : MGSSHHHHHH...
Displaying 5521 to 5530 (of 7269 Products)
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein