About LifeTein Peptide

The custom peptide synthesis service and custom antibody product service company.

New Service Available now: Order Gene Synthesis Service!

Order your Gene Synthesis Service at a competitive price! Now it is 30% off. Email us at gene@lifetein.com for a quote.

LifeTein Gene Synthesis Service

Order now: https://www.lifetein.com/protein-expression-service.html

Oligo-peptide conjugation

Oligo-peptide conjugation

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

How do peptides fold?

Monitoring T cell–dendritic cell interactions in vivo using labeled peptides

How HIV-1 integrase contributes to virion morphogenesis?

How HIV-1 integrase contributes to virion morphogenesis?

It was found that the HIV-1 Integrase binds the Viral RNA genome and is essential during Virion Morphogenesis. The L50 Peptide: Cyclo-(-Arg-Val-Arg-Thr-Arg-Gly-LysArg-Arg-Ile-Arg-Arg-DPro-Pro-) was synthesized by LifeTein and used for the inhibition assays. The L50 is a Tat-derived peptide sequence, which selectively engages both the loop and 3-nt bulge
but not the double-stranded stem of transactivation response. The TAT-derived peptide is a well-defined cell penetration peptide.

HIV-1 Integrase Binds the Viral RNA genome

Cell Penetration Peptides

Cell Penetration Peptides

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

New Service Available now: Order Gene Synthesis Service!

How do peptides fold?

Monitoring T cell–dendritic cell interactions in vivo using labeled peptides

Monitoring T cell–dendritic cell interactions in vivo using labeled peptides

The SrtA substrates Biotin–aminohexanoic acid–LPETGS and SELPETGG were used for the interactions between immune cells ‘Labelling Immune Partnerships by SorTagging Intercellular Contacts’ (LIPSTIC). The peptide-receptor interactions enable the direct measurement of dynamic cell–cell interactions. The peptides are flexible tools for use with different receptor–ligand pairs and a range of detectable labels.

peptide-receptor interaction

Schematic representation of the LIPSTIC approach

 

Nature, Monitoring T cell–dendritic cell interactions in vivo by intercellular enzymatic labelling

Peptide Biotin–aminohexanoic acid–LPETGS, SELPETGG was purchased from LifeTein.

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

New Service Available now: Order Gene Synthesis Service!

How do peptides fold?

How HIV-1 integrase contributes to virion morphogenesis?

How do peptides fold?

peptide fold

Short Peptide Folding

How does the amino acid sequence of a protein chain determine and remain its 3D folded state? How do small proteins fold?

Short Peptide Folding

Many small proteins or miniproteins are peptides shorter than 40-50 residues with stable folding that contain secondary structure elements such as alpha helices and beta strands. An autonomously folding, 35 residue, thermostable subdomain (HP36) of the villin headpiece, is the smallest folded domain of a naturally occurring protein. So, polypeptides simplify the protein-folding problem. It allows in-depth examinations of sequence-structure-stability relationships without using the complex larger proteins. In this recent study, Rocklin et al. designed sequences intended to fold into desired structures. The novel proteins may be useful in bioengineering or pharmacological applications. Check the paper from here: https://goo.gl/Tregb7 http://science.sciencemag.org/content/357/6347/168

Peptide Synthesis Home Page

Our Services: COVID-19 Services & Products Custom Antibody Services Rush Peptide Synthesis Peptide Nucleic Acids (PNAs) Custom Peptide Synthesis Services Gene Synthesis Service Custom Chemical Synthesis Other Posts: New Service Available now: Order Gene Synthesis Service! Monitoring T cell–dendritic cell interactions in vivo using labeled peptides How HIV-1 integrase contributes to virion morphogenesis?

LifeTein Launches Rush Custom Peptide Synthesis Service: Peptide Delivered in 3-5 Days

LifeTein is unveiling an expedited peptide synthesis program, promising to place peptides in its customers’ hands within 3-5 business days. The RushPep™ peptide synthesis service was designed to circumvent the existing limitations of conventional solid-phase peptide synthesis (SPPS), which involves a long coupling time and low yield. RushPep™ shortens the time needed for individual coupling, deprotection and washing steps. The proprietary methodology renders processing ten times faster than in classical synthesis while simultaneously circumventing the limitations caused by the formation of by-products or intermediates to which traditional SPPS approaches are subject.

LifeTein’s Rush Custom Peptide Synthesis Service

“When designing the RushPep™ methodology, our focus was to not only to produce peptides of high quality and purity but also to offer a streamlined solution that would increase the efficiency of researchers’ protein discovery workflows,” stated Dr. Ya Chen, Head of LifeTein’s Rush Peptide Synthesis Group. “RushPep™ achieves these goals by synthesizing the peptides in 3–5 business days to accelerate research and discovery.”

Chen continued, “The reliability of RushPep™ rush peptide synthesis ensures that the peptides are finished in 3–5 business days with high-batch-to-batch reproducibility. ” Most of the crude peptides have a purity of over 80%. RushPep™ peptide service is valuable for the scientists and researchers because it allows them to finish their proteomics projects in a fast and cost-efficient manner.

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

Peptides for Parkinson’s disease (PD)

ID2 peptide for inhibition of tumour growth

How does BIRD-2 peptide kill B-cell lymphoma?

Look Who’s Talking

Peptides for Parkinson’s disease (PD)

All peptides used in this study for Parkinson’s disease were synthesized by LifeTein. The α-synuclein is an indication in the pathogenesis of Parkinson’s disease. It was found that a molecular mimicry mechanism between HSV1 and human α-synuclein could trigger PD.

LifeTein Peptides & Parkinson’s Disease

Journal of Neuroimmunology, doi:10.1016/j.jneuroim.2016.01.007 Humoral cross reactivity between α-synuclein and herpes simplex − 1 epitope in Parkinson’s disease, a triggering role in the disease?

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

ID2 peptide for inhibition of tumour growth

How does BIRD-2 peptide kill B-cell lymphoma?

Look Who’s Talking

LifeTein Launches Rush Custom Peptide Synthesis Service: Peptide Delivered in 3-5 Days

ID2 peptide for inhibition of tumour growth

Biotinylated wild-type and modified (pT27 and T27W) ID2 peptides (amino acids 14–34) were synthesized by LifeTein. ID2 binds to the VHL ubiquitin ligase complex.This ID2 peptide could be used to inhibit tumour growth for patients with glioblastoma.

LifeTein’s ID2 Peptides Can Inhibit Tumour Growth

Nature, 529, 172–177 (14 January 2016) doi:10.1038/nature16475, An ID2-dependent mechanism for VHL inactivation in cancer.

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

Peptides for Parkinson’s disease (PD)

How does BIRD-2 peptide kill B-cell lymphoma?

Look Who’s Talking

LifeTein Launches Rush Custom Peptide Synthesis Service: Peptide Delivered in 3-5 Days

How BIRD-2 Peptide Takes Down B-Cell Lymphoma?

The anti-apoptotic factor Bcl-2 is over-expressed in B-cell lymphoma cells as their main survival mechanism by binding to IP3R2 on the endoplasmic reticulum (ER).  In this study, a cell-penetrating version of the BIRD-2 peptide (Bcl-2/IP3R Disrupter-2 peptide with a TAT sequence) made by LifeTein was used to break up the complex formed by Bcl-2 and IP3R2 in human diffuse large B-cell lymphoma (DLBCL) cells. Ca2+ signaling-related events are suggested to be the killing mechanism of BIRD-2 peptide on DLBCL cells.

BIRD-2, a peptide that specifically disrupts the Bcl2/IP3R complex, was utilized to further verify the mitochondrial Ca2+ regulatory mechanism via the Bmal1-Bcl2/IP3R signaling pathway. It was found that BIRD-2 aggravated mitochondrial Ca2+ overload and apoptosis in vitro.

Purchase BIRD-2 peptide now. Click here.

BIRD-2 peptide (sequence: RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV) was purchased from LifeTein (South Plainfield, NJ, USA) with a purity of >85%.

Bird-2 Peptides & B-Cell Lymphoma

Reference:

BIRD-2 peptide (LifeTein, USA), specifically disrupting the Bcl2/IP3R complex, was used in HGHP-treated H9c2 cells for 12 h (20 μM)

Inhibiting Bcl-2 via its BH4 domain in DLBCL cancers to provoke pro-apoptotic Ca2+ signaling

BIRD-2, a BH4-domain-targeting peptide of Bcl-2, provokes Bax/Bak-independent cell death in B-cell cancers through mitochondrial Ca2+-dependent mPTP opening

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

Peptides for Parkinson’s disease (PD)

ID2 peptide for inhibition of tumour growth

Look Who’s Talking

LifeTein Launches Rush Custom Peptide Synthesis Service: Peptide Delivered in 3-5 Days

Look Who’s Talking

Intraspecies pheromone signaling regulated by proteases is critical for fungi procreation.  The fungal aspartyl protease Bar1 was shown to have unique substrate specificity of important implications in fungal evolution.  LifeTein synthesized substrate peptides of Bar1, dual-tagged with DABCYL and EDANS, from the sequence of α pheromone, the native target of Bar1. Referred as internally quenched or IQ peptides, they were used in fluorescence resonance energy transfer (FRET) assays to study the enzyme kinetics of Bar1.

LifeTein’s Internally Quenched Peptides

mBio 6(6):e01604-15. doi:10.1128/mBio.01604-15. Evolutionary selection on barrier activity: Bar1 is an aspartyl protease with novel substrate specificity.

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

Peptides for Parkinson’s disease (PD)

ID2 peptide for inhibition of tumour growth

How does BIRD-2 peptide kill B-cell lymphoma?

LifeTein Launches Rush Custom Peptide Synthesis Service: Peptide Delivered in 3-5 Days

A New Patent Using Peptides

A patent has been published that describes new methods of manipulating plant stomatal development through artificially controlling how CRSP is expressing in plant cells.  The cleavage of epidermal patterning factor 2 (EPF2) by a serine protease CRSP is a key regulating mechanism in plant stomatal development.  A 30-mer EPF2 peptide, dual-tagged with DABCYL and EDANS, was synthesized by LifeTein to evaluate the protease activity of synthetic CRSP in a FRET assay.

New Patent Using Peptides Synthesized By LifeTein

Compositions and methods for mediating plant stomatal development in response to carbon dioxide and applications for engineering drought tolerance in plants.

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

Nanoparticles Get Help from Cell-Permeable Peptides

Predicting type 1 diabetes in children

Improving Antibody Therapy For Colorectal Cancer

A tumor-permeable peptide iRGD by LifeTein targets peritoneal carinomatosis

To Make Simpler and Better Biosensors