How to generate highly stable D-amino acid analogs of bioactive helical peptides?

Using D-amino acids as the building blocks for bioactive peptides can dramatically increase their potency. In this study, the authors generated a database of ∼2.8 million D-peptides using a mirror image of every structure in the Protein Data Bank (PDB). The critical or hotspot residues were studied. Residues critical to target binding and activity can then be ideally done experimentally such as alanine scanning mutagenesis. It can also be carried out computationally such as thermodynamic integration or free energy perturbation.

D-Amino Acids for Bioactive Peptides

Two peptides were tested to prove the concept: GLP-1 and Parathyroid Hormone. Both (L)- and (D)-peptides were synthesized by Lifetein LLC.

  1. GLP-1 is a helical GPCR agonist as a diabetes mellitus and obesity treatment. Hotspot and junction residues are annotated in green and blue, respectively. The authors investigated the ability of (D)-GLP1 peptide to induce activation of GLP1R and compared the response with native (L)-GLP1 peptide. It was found that the D-GLP-1 performed well and resistance to protease degradation. The retro-inversion (RI) reversing the (D)-peptide sequence was used in the experiment.
D amino acid peptides

D amino acid peptides

Glucagon-Like Peptide 1, GLP – 1 (7 – 36), amide, human: 
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR – NH2

2.  Parathyroid Hormone (PTH) is an FDA-approved treatment for osteoporosis. The (D)-PTH activates PTH1R with a potency and efficacy comparable to (L)-PTH. And more than 85% of the (D)-PTH analog is still detectable at six hours.

PTH 1-34: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Conclusion: The D-Protein Data Bank (PDB) can be used to search and find therapeutically active topologies. The D-PDB could be a key tool for finding stable lead molecules in early-stage drug discovery.

Hot spot residues for receptor binding

Hot spot residues for receptor binding

Reference: 

Method to generate highly stable D-amino acid analogs of bioactive helical peptides using a mirror image of the entire PDB

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

Noble metal gold and silver nanoparticle are conjugated with peptides for cellular imaging

A six-mer synthetic peptide (AT1002) showed enhanced nasal drug delivery

A simple protocol: Maleimide labeling of peptide and other thiolated biomolecules