Corticotropin Releasing Factor, human, rat [86784-80-7]

Product Name
Corticotropin Releasing Factor, human, rat [86784-80-7]
Product Quantity
1mg
Catalog Number
LT8173
Category
Peptide
Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, amidation
Purity
>95%
Chemistry
  • Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
  • CAS registry number: 86784-80-7
  • Formular: C208H344N60O63S2
  • Molecular Weight: 4575.5
Product Description
Corticotropin-Releasing-Factor

An immunomodulatory neuropeptide that acts to release ACTH from the anterior pituitary and stimulates the sympathetic nervous system and adrenal medulla.

Function

Corticotropin-Releasing Factor (CRF) is a pivotal hormone in the human and rat endocrine system. It primarily functions in the stress response by stimulating the pituitary synthesis and secretion of adrenocorticotropic hormone (ACTH). This, in turn, triggers the adrenal cortex to release cortisol in humans or corticosterone in rats. CRF also plays a role in regulating various physiological responses, including behavioral, cardiovascular, immune, and gastrointestinal functions.

Structure

CRF is a peptide hormone, typically comprising a sequence of amino acids. In humans and rats, the structure of CRF is similar but not identical, reflecting their evolutionary relationship. The peptide binds to CRF receptors, which are part of the G protein-coupled receptor family, triggering a cascade of intracellular events.

Application

In medical research and clinical applications, CRF is often used to study and understand stress-related physiological responses and disorders, including anxiety, depression, and post-traumatic stress disorder (PTSD). It also has potential therapeutic applications in treating these conditions.

For precise information on the molecular formula, weight, and specific applications of Corticotropin Releasing Factor in humans and rats, a more focused search or reference to specialized biochemical databases would be required.

Scientific Background

Corticotropin Releasing Factor, human, rat [86784-80-7] is a 41-residue synthetic peptide with the sequence Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile. C-terminal amidation removes the terminal carboxylate charge. The sequence contains 1 Lys and 3 Arg residues, contributing cationic character. These sequence-derived properties describe the reagent chemically; no specific receptor, enzyme, pathway, disease association, or biological activity is assigned without product-specific experimental evidence.

Research Applications
  • LC-MS/HPLC analytical method development
  • sequence-specific assay controls
Experimental Notes

Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended experimental conditions.

  • 2 Units in Stock
Ask a Question

$350.00$99.00Save: 72% off

Add to Cart: