PYY (3-36) (human), with the sequence IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 and a molecular weight of 4049.52 g/mol, is a biologically active peptide derived from the human gastrointestinal tract. This peptide functions as a selective agonist for the Y2 receptor, which plays a crucial role in the regulation of appetite and energy homeostasis.
Applications in Biological Research
PYY (3-36) is extensively studied in the context of appetite regulation and obesity research. Released from the gastrointestinal tract in response to food intake, this peptide signals satiety by binding to the Y2 receptors in the brain, particularly in the hypothalamus. Research has shown that peripheral administration of PYY (3-36) in animal models, such as rats, leads to a significant reduction in food intake and inhibits weight gain. These effects are of great interest in the study of metabolic disorders and the development of anti-obesity therapies.
Function and Mechanisms of Action
The primary mechanism by which PYY (3-36) exerts its effects involves the activation of the Y2 receptors, which are part of the neuropeptide Y (NPY) receptor family. Upon binding to these receptors, PYY (3-36) reduces the release of NPY, a potent stimulant of food intake, thereby decreasing appetite. In human studies, infusion of PYY (3-36) has been shown to significantly suppress appetite and reduce caloric intake by approximately 33% over a 24-hour period, highlighting its potential role in long-term regulation of food intake and body weight management.
Significance in Drug Development
Given its strong appetite-suppressing effects, PYY (3-36) is considered a promising candidate for the development of new treatments for obesity and related metabolic disorders. By mimicking the natural satiety signals of the body, drugs based on PYY (3-36) could help regulate food intake and promote weight loss in individuals struggling with obesity, making it a critical area of research in the fight against this global health issue.
Molecular and Storage Information
This peptide has the chemical formula C180H279N53O54 and is typically stored under conditions that preserve its stability, such as low temperatures, to maintain its bioactivity for research applications.
PYY (3-36) (human) is an essential peptide for researchers exploring the complex mechanisms of appetite regulation, energy balance, and obesity treatment, offering significant potential for therapeutic development. | 